abcdefghijklmnopqrstuvwxyz#

Download emergency Regular font

emergency Regular

emergency Regular

Font family: Emergency

Font subfamily identification: Regular

Unique identifier: VladimirNikolic Emergency Regular 2020

Full font name: Emergency Regular

Version: Version 1. 000

Postscript font name: Emergency-Regular

Trademark notice: Emergency Regular is a trademark of Vladimir Nikolic.

Manufacturer name: Vladimir Nikolic

Designer: Vladimir Nikolic

Description: Copyright c 2020 by Vladimir Nikolic. All rights reserved.

https www. coroflot. comvladimirnikolic

https www. coroflot. comvladimirnikolic

Emergency Regular

Font styleCharmap ImageCharmap Text

  • emergency Regular | Emergency.ttf - 23 chars

    emergency Regular
  • Embed emergency Regular Font
    To embed your selected fonts into a webpage, copy this code into the <head> of your HTML document
    <link href="https://www.dafontfree.net/embed/ZW1lcmdlbmN5LXJlZ3VsYXImZGF0YS8zMTAvZS8yMzcyNjgvRW1lcmdlbmN5LnR0Zg" rel="stylesheet" type="text/css"/>
    Specify in CSS
    Use the following CSS rules to specify these families:
    font-family: 'emergency-regular', sans-serif;
emergency Regular
emergency Regular
emergency Regular
� ABCDEFGHIJabcdefghij
  • File name: emergency.zip
  • File size: 188.88 Kb
  • 826 views, 97 downloads, 0 comment(s)
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Download free fontsDingbatsStencil, Army vladimir nikolicemergencyDingbatsStencilArmydingbatsstencil armyttfemergencyttfvladimirnikolicstencilarmy

Comments (0)

  • no-avatar

    Other fonts ...

    B1

    B2

    B3

    genieesspv

    C4

    HTML Link

    Top