abcdefghijklmnopqrstuvwxyz#

Download flame-fetish Regular font

flame-fetish Regular

flame-fetish Regular

Font family: Flame Fetish

Font subfamily identification: Regular

Unique identifier: Version 1. 000 MHrs FlameFetish-Regular 2019 FLVI-612

Full font name: Flame Fetish Regular

Version: Version 1. 000

Postscript font name: FlameFetish-Regular

Trademark notice: Flame Fetish Regular is a trademark of Misti "s Fonts.

Manufacturer name: Misti "s Fonts

Designer: Misti "s Fonts

Description: Copyright c 2019 by Misti "s Fonts. All rights reserved.

www. mistifonts. com

www. mistifonts. com

Font styleCharmap ImageCharmap Text

  • flame-fetish Regular | Flame Fetish - TTF.ttf - 237 chars

    flame-fetish Regular
  • Embed flame-fetish Regular Font
    To embed your selected fonts into a webpage, copy this code into the <head> of your HTML document
    <link href="https://www.dafontfree.net/embed/ZmxhbWUtZmV0aXNoLXJlZ3VsYXImZGF0YS83NTgvZi8yMTM4MzkvRmxhbWUgRmV0aXNoIC0gVFRGLnR0Zg" rel="stylesheet" type="text/css"/>
    Specify in CSS
    Use the following CSS rules to specify these families:
    font-family: 'flame-fetish-regular', sans-serif;
flame-fetish Regular
flame-fetish Regular
flame-fetish Regular
flame-fetish Regular
flame-fetish Regular
flame-fetish Regular
flame-fetish Regular
flame-fetish Regular
� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ\^_`abcdefghijklmnopqrstuvwxyz|~¡£¨´¸¿ÀÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÐÑÒÓÔÕÖØÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõöøùúûüýþÿĂ㥹ĆćČčĎďĐđĘęĚěıĹ弾ŁłŃńŇňŐőŒœŔŕŘřŚśŞşŠšŢţŤťŮůŰűŸŹźŻżŽžˆˇ˘˙˚˛˜˝‘’‚“”„€
  • File name: flame-fetish.zip
  • File size: 59.75 Kb
  • 733 views, 64 downloads, 0 comment(s)
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
ArtCalligraphyFire - IceDownload free fontsScript calligraphyconnectedcursivefireflamescriptswashmisti's fontsflame fetishfire - icettfflame-fetishflame fetish - ttfttffetishmistisfontsicettfttf

Comments (0)

  • no-avatar

    Other fonts ...

    B1

    B2

    B3

    genieesspv

    C4

    HTML Link

    Top