Download free BPtypewriteDamagedSlashed Italic font | BPtypewriteDamagedSlashedItalics.ttf
(0 vote)
BPtypewriteDamagedSlashed Italic font by Fonts me. File script name BPtypewriteDamagedSlashedItalics.ttf download free for Personal Use.
About BPtypewriteDamagedSlashed Italic font
www.backpacker.grDownload font
Free for Personal Use
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
- BPtypewriteDamagedSlashedItalics.ttf
Image Demo
BPtypewriteDamagedSlashed Italic | BPtypewriteDamagedSlashedItalics.ttf
- Font family: BPtypewriteDamagedSlashed
- Font subfamily identification: Italic
- Unique identifier: GeorgeTriantafyllakos: BPtypewriteDamagedSlashed Italic: 2010
- Full font name: BPtypewriteDamagedSlashed Italic
- Version: Version 1. 000
- Postscript font name: BPtypewriteDamagedSlashed-Itali
- Trademark notice: BPtypewriteDamagedSlashed Italic is a trademark of George Triantafyllakos.
- Manufacturer name: George Triantafyllakos
- Designer: George Triantafyllakos
- Description: Copyright c 2010 by . All rights reserved.
#bptypewritedamagedslashed#italic#bptypewritedamagedslashed italic#italic font#bptypewritedamagedslashed italic font#download#free#download free#free fonts#download free fonts#typerwriter#grungetrash#bptypewritedamagedslasheditalicsttf#windows#ttf#bptypewritedamagedslasheditalics#bptypewritedamagedslashed-itali#george#triantafyllakos#george triantafyllakos
Comments (0)
Please login!
