abcdefghijklmnopqrstuvwxyz#

Download kids-drawings Regular font

kids-drawings Regular

kids-drawings Regular

Font family: Kids Drawings

Font subfamily identification: Regular

Unique identifier: VladimirNikolic Kids Drawings Regular 2019

Full font name: Kids Drawings Regular

Version: Version 1. 000

Postscript font name: KidsDrawings-Regular

Trademark notice: Kids Drawings Regular is a trademark of Vladimir Nikolic.

Manufacturer name: Vladimir Nikolic

Designer: Vladimir Nikolic

Description: Copyright c 2019 by Vladimir Nikolic. All rights reserved.

https www. coroflot. comvladimirnikolic

https www. coroflot. comvladimirnikolic

Kids Drawings Regular

Font styleCharmap ImageCharmap Text

  • kids-drawings Regular | KidsDrawings.ttf - 35 chars

    kids-drawings Regular
  • Embed kids-drawings Regular Font
    To embed your selected fonts into a webpage, copy this code into the <head> of your HTML document
    <link href="https://www.dafontfree.net/embed/a2lkcy1kcmF3aW5ncy1yZWd1bGFyJmRhdGEvODY1L2svMjE1NDEyL0tpZHNEcmF3aW5ncy50dGY" rel="stylesheet" type="text/css"/>
    Specify in CSS
    Use the following CSS rules to specify these families:
    font-family: 'kids-drawings-regular', sans-serif;
kids-drawings Regular
kids-drawings Regular
kids-drawings Regular
� ABCDEFGHIJKLMNOPabcdefghijklmnop
  • File name: kids-drawings.zip
  • File size: 22.5 Kb
  • 752 views, 50 downloads, 0 comment(s)
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
PeopleKidsDownload free fontsDingbats vladimir nikolickids drawingsDingbatsKidsdingbatskidsttfkids-drawingskidsdrawingsttfdrawingsvladimirnikolic

Comments (0)

  • no-avatar

    Other fonts ...

    B1

    B2

    B3

    genieesspv

    C4

    HTML Link

    Top