abcdefghijklmnopqrstuvwxyz#

Download markh-exp Regular font

markh-exp Regular

markh-exp Regular

Font family: Markh Exp

Font subfamily identification: Regular

Unique identifier: Version 1. 000 Markh-Expanded 2018 FLVI-600

Full font name: Markh Expanded

Version: Version 1. 000

Postscript font name: Markh-Expanded

Trademark notice: Markh is a trademark of Tikhon Reztcov Moscow.

Manufacturer name: Tikhon Reztcov

Designer: Tikhon Reztcov

Description: Copyright c Tikhon Reztcov Moscow, 2018. All rights reserved.

https www. behance. nettreztcov

Markh

Expanded

Font styleCharmap ImageCharmap Text

  • markh-exp Regular | markh-regular.ttf - 316 chars

    markh-exp Regular
  • Embed markh-exp Regular Font
    To embed your selected fonts into a webpage, copy this code into the <head> of your HTML document
    <link href="https://www.dafontfree.net/embed/bWFya2gtZXhwLXJlZ3VsYXImZGF0YS82MS9tLzIxMDA5MC9tYXJraC1yZWd1bGFyLnR0Zg" rel="stylesheet" type="text/css"/>
    Specify in CSS
    Use the following CSS rules to specify these families:
    font-family: 'markh-exp-regular', sans-serif;
markh-exp Regular
markh-exp Regular
markh-exp Regular
markh-exp Regular
markh-exp Regular
markh-exp Regular
markh-exp Regular
markh-exp Regular
markh-exp Regular
markh-exp Regular
!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~¡¢¥¦¨©«®°±²´»¿ÀÁÂÃÄÅÆÈÉÊËÌÍÎÏÐÑÒÓÔÕÖ×ØÙÚÛÜÝÞßàáâãäåæèéêëìíîïðñòóôõö÷øùúûüýþÿŁłŒœŠšŸŽžˆˇ˘˚˜ЁЇАБВГДЕЖЗИЙКЛМНОПРСТУФХЦЧШЩЪЫЬЭЮЯабвгдежзийклмнопрстуфхцчшщъыьэюяёїְֱֲֳִֵֶַָֹֻּֿאבגדהוזחטיךכלםמןנסעףפץצקרשתװױײ–—‘’‚“”„•…‰‹›₪€№™−שׁשׂ
  • File name: markh-exp.zip
  • File size: 17.99 Kb
  • 651 views, 96 downloads, 0 comment(s)
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Download free fontsBasicSans serifDesign tutorialsDesign basicsStencil, Army basic fontdisplay fontsans serifstencil - armymarkh expTikhon Reztcovbasicstencil armyttfmarkh-expmarkh-regularttfmarkhexpfontdisplaysansserifstencilarmytikhonreztcovregularttf

Comments (0)

  • no-avatar

    Other fonts ...

    B1

    B2

    B3

    genieesspv

    C4

    HTML Link

    Top