abcdefghijklmnopqrstuvwxyz#

Download mayasi-free Regular font

mayasi-free Regular

mayasi-free Regular

Font family: Mayasi FREE

Unique identifier: Inspiratype Mayasi FREE 2020

Full font name: Mayasi FREE

Version: Version 1. 000

Postscript font name: MayasiFREE

Trademark notice: Mayasi FREE is a trademark of Inspiratype.

Manufacturer name: Inspiratype

Designer: Inspiratype

Description: Copyright c 2020 by Inspiratype. All rights reserved.

Font subfamily identification: Regular

Font styleCharmap ImageCharmap Text

  • mayasi-free Regular | Mayasifree-VGqmZ.otf - 55 chars

    mayasi-free Regular
  • Embed mayasi-free Regular Font
    To embed your selected fonts into a webpage, copy this code into the <head> of your HTML document
    <link href="https://www.dafontfree.net/embed/bWF5YXNpLWZyZWUtcmVndWxhciZkYXRhLzc5NS9tLzIzNzkxNi9NYXlhc2lmcmVlLVZHcW1aLm90Zg" rel="stylesheet" type="text/css"/>
    Specify in CSS
    Use the following CSS rules to specify these families:
    font-family: 'mayasi-free-regular', sans-serif;
mayasi-free Regular
mayasi-free Regular
mayasi-free Regular
mayasi-free Regular
� ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz
  • File name: mayasi-free.zip
  • File size: 13.47 Kb
  • 970 views, 84 downloads, 0 comment(s)
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Download free fontsScriptBrush scripthandwritingbrushhand drawninspirasignmayasi freeotfmayasi-freemayasifree-vgqmzotfmayasifreehanddrawnmayasifreevgqmzotf

Comments (0)

  • no-avatar

    Other fonts ...

    B1

    B2

    B3

    genieesspv

    C4

    HTML Link

    Top