abcdefghijklmnopqrstuvwxyz#

Download medina Outline font

medina Outline

medina Outline

Font family: Medina

Font subfamily identification: Outline

Unique identifier: Medina-Outline-2015 5 6

Full font name: Medina Outline

Version: 1

Postscript font name: Medina-Outline

Webfont 1. 0

Wed May 6 13 34 20 2015

default

taurus

Font Squirrel

Font styleCharmap ImageCharmap Text

  • medina Outline | medina-outline-webfont.ttf - 211 chars

    medina Outline
  • Embed medina Outline Font
    To embed your selected fonts into a webpage, copy this code into the <head> of your HTML document
    <link href="https://www.dafontfree.net/embed/bWVkaW5hLW91dGxpbmUmZGF0YS8zOTUvbS8yMDUzNTMvbWVkaW5hLW91dGxpbmUtd2ViZm9udC50dGY" rel="stylesheet" type="text/css"/>
    Specify in CSS
    Use the following CSS rules to specify these families:
    font-family: 'medina-outline', sans-serif;
medina Outline
medina Outline
medina Outline
medina Outline
medina Outline
medina Outline
medina Outline
medina Outline
  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ¡¢£¥¨©ª­®°´¸º¿ÀÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÑÒÓÔÕÖ×ØÙÚÛÜßàáâãäåæçèéêëìíîïñòóôõöøùúûüÿŒœŸˆ˜           ‐‑‒–—‘’‚“”•…  ™◼
  • File name: medina.zip
  • File size: 78.33 Kb
  • 963 views, 72 downloads, 0 comment(s)
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Download free fontsBrushGrunge/TrashHTML LinkScriptForeignVariousVariousTechnoVarious display fontalternatebrush fontcaligraphyfilm titlesgiggrungegrunge brusheshandcraftedhandmadehandrawnhappyinklabelmedina brushmedina brush fontmessynatural messyposterscriptswashtypefacevacationmedinabrushvariousgrungetrashttfmedina-outline-webfontttfdisplayfontfilmtitlesbrushesnaturaloutlinewebfontttf

Comments (0)

  • no-avatar

    Other fonts ...

    B1

    B2

    B3

    genieesspv

    C4

    HTML Link

    Top