abcdefghijklmnopqrstuvwxyz#

Download Ptarmigan Italic font

Ptarmigan Italic

Ptarmigan Italic

Font family: Ptarmigan

Font subfamily identification: Italic

Unique identifier: TMF Ptarmigan Italic

Full font name: Ptarmigan Italic

Version: v1. 0 - 13 May 2001

Postscript font name: PtarmiganItalic

Font styleCharmap ImageCharmap Text

  • Ptarmigan Italic | ptarmigan.italic.ttf - 224 chars

    Ptarmigan Italic
  • Embed Ptarmigan Italic Font
    To embed your selected fonts into a webpage, copy this code into the <head> of your HTML document
    <link href="https://www.dafontfree.net/embed/cHRhcm1pZ2FuLWl0YWxpYyZkYXRhLzE0MS9wLzE3MjU0Ny9wdGFybWlnYW4uaXRhbGljLnR0Zg" rel="stylesheet" type="text/css"/>
    Specify in CSS
    Use the following CSS rules to specify these families:
    font-family: 'ptarmigan-italic', sans-serif;
Ptarmigan Italic
Ptarmigan Italic
Ptarmigan Italic
Ptarmigan Italic
Ptarmigan Italic
Ptarmigan Italic
Ptarmigan Italic
Ptarmigan Italic
  • File name: ptarmigan.zip
  • File size: 20.74 Kb
  • 1,202 views, 59 downloads, 0 comment(s)
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Download free fontsSans serifItalicBlurredVietnamese sans serifsleekheadlinesitalicnarrowblackheavywidesans-serifnatepid monkey fontsptarmiganptarmigan regularptarmigan italicptarmigan condsansseriftepidmonkeyfontsregularcondptarmiganitalicttfblurredfont viet namdownload free fonts

Comments (0)

  • no-avatar

    Other fonts ...

    B1

    B2

    B3

    genieesspv

    C4

    HTML Link

    Top