abcdefghijklmnopqrstuvwxyz#

Download roll-accurate Regular font

roll-accurate Regular

roll-accurate Regular

Font family: Roll Accurate

Font subfamily identification: Regular

Unique identifier: Roll Accurate Version 1. 00

Full font name: Roll Accurate

Version: Version 1. 00 February 14, 2019 FontCreator 11. 5. 0. 2430 64-bit

Postscript font name: RollAccurate

Trademark notice: Roll Accurate by Chequered Ink.

Designer: Allison James

Description: This font was created using FontCreator 11. 5 from High-Logic. com

http chequered. ink

Font styleCharmap ImageCharmap Text

  • roll-accurate Regular | Roll Accurate.otf - 100 chars

    roll-accurate Regular
  • Embed roll-accurate Regular Font
    To embed your selected fonts into a webpage, copy this code into the <head> of your HTML document
    <link href="https://www.dafontfree.net/embed/cm9sbC1hY2N1cmF0ZS1yZWd1bGFyJmRhdGEvOTgvci8yMTU4MjMvUm9sbCBBY2N1cmF0ZS5vdGY" rel="stylesheet" type="text/css"/>
    Specify in CSS
    Use the following CSS rules to specify these families:
    font-family: 'roll-accurate-regular', sans-serif;
roll-accurate Regular
roll-accurate Regular
roll-accurate Regular
roll-accurate Regular
roll-accurate Regular
� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ­;
  • File name: roll-accurate.zip
  • File size: 14.24 Kb
  • 786 views, 48 downloads, 0 comment(s)
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Download free fontsStencil, ArmyArt armybattlecleancutmarinemetalnavystencilwarwartimechequered inkroll accuratestencil armyotfroll-accurateroll accurateotfrollaccuratechequeredinkaccurateotf

Comments (0)

  • no-avatar

    Other fonts ...

    B1

    B2

    B3

    genieesspv

    C4

    HTML Link

    Top