abcdefghijklmnopqrstuvwxyz#

Download wilder-vintage Bold font

wilder-vintage Bold

wilder-vintage Bold

Font family: Wilder Vintage

Font subfamily identification: Bold

Unique identifier: swistblnk Wilder Vintage 2014

Full font name: Wilder Vintage

Version: Version 1. 000

Postscript font name: WilderVintage

Trademark notice: Wilder Vintage is a trademark of swistblnk.

Manufacturer name: swistblnk

Description: Copyright c 2014 by swistblnk. All rights reserved.

Wilder Vintage

Font styleCharmap ImageCharmap Text

  • wilder-vintage Bold | Wilder Vintage.ttf - 84 chars

    wilder-vintage Bold
  • Embed wilder-vintage Bold Font
    To embed your selected fonts into a webpage, copy this code into the <head> of your HTML document
    <link href="https://www.dafontfree.net/embed/d2lsZGVyLXZpbnRhZ2UtYm9sZCZkYXRhLzI5Ni93LzE5NzkwMi9XaWxkZXIgVmludGFnZS50dGY" rel="stylesheet" type="text/css"/>
    Specify in CSS
    Use the following CSS rules to specify these families:
    font-family: 'wilder-vintage-bold', sans-serif;
wilder-vintage Bold
wilder-vintage Bold
wilder-vintage Bold
wilder-vintage Bold
!"#$%&'()*+,-./0123456789:;=?@ABCDEFGHIJKLMNOPQRSTUVWXYZ_abcdefghijklmnopqrstuvwxyz
  • File name: wilder-vintage.zip
  • File size: 268.73 Kb
  • 795 views, 89 downloads, 0 comment(s)
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
ForeignVariousDownload free fontsVariousTechnoVarious blacklettermiscfamilyhanddrawnhanddrawn kitkitwilderwilder familywilder boldwilder regularwilder vintageboldregularvintagevariousotfwilder-boldwilder boldotfboldotfttfwilder boldttfboldttfwilder-regularwilder regularotfregularotfwilder regularttfregularttfwilder-vintagewilder vintageotfvintageotfwilder vintagettfvintagettf

Comments (0)

  • no-avatar

    Other fonts ...

    B1

    B2

    B3

    genieesspv

    C4

    HTML Link

    Top