abcdefghijklmnopqrstuvwxyz#

Download yogaism Regular font

yogaism Regular

yogaism Regular

Font family: Yogaism

Font subfamily identification: Regular

Unique identifier: Yogaism

Full font name: Yogaism

Version: 1. 0 2007-09-22

Postscript font name: Yogaism

Font styleCharmap ImageCharmap Text

  • yogaism Regular | Yogaism.ttf - 214 chars

    yogaism Regular
  • Embed yogaism Regular Font
    To embed your selected fonts into a webpage, copy this code into the <head> of your HTML document
    <link href="https://www.dafontfree.net/embed/eW9nYWlzbS1yZWd1bGFyJmRhdGEvMTc2L3kvMTg4NjUyL1lvZ2Fpc20udHRm" rel="stylesheet" type="text/css"/>
    Specify in CSS
    Use the following CSS rules to specify these families:
    font-family: 'yogaism-regular', sans-serif;
yogaism Regular
yogaism Regular
yogaism Regular
yogaism Regular
yogaism Regular
yogaism Regular
yogaism Regular
yogaism Regular
  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~¡¢£¤¥§¨©ª«¬®¯°±´µ·¸º»¿ÀÁÂÃÄÆÇÈÉÊËÌÍÎÏÐÑÒÓÔÕÖ×ØÙÚÛÜÝÞßáâãäåæçèéêëìíîïñòóôõö÷øùúûüÿŒœŸƒˆ˜–—‘’‚‛“”„‟†‡•…‰‹›™∙
  • File name: yogaism.zip
  • File size: 180.44 Kb
  • 939 views, 97 downloads, 0 comment(s)
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
ForeignVariousDownload free fontsVariousTechnoVarious yogaismregularfontspecificmanfredkleinseptvariousttfyogaismttf

Comments (0)

  • no-avatar

    Other fonts ...

    B1

    B2

    B3

    genieesspv

    C4

    HTML Link

    Top