Download zawgyi-one Regular font

zawgyi-one Regular

zawgyi-one Regular

Font family: Zawgyi-One

Font subfamily identification: Regular

Unique identifier: Zawgyi-One 3. 0

Full font name: Zawgyi-One

Version: 3. 0 December 4, 2007

Postscript font name: Zawgyi-One

Trademark notice: Zawgyi-One Myanmar Unicode font is released by Zawgyi. net and Alpha Mandalay.

Manufacturer name: Zawgyi. net

Designer: Zaw Win Myat a Art House

http www. zawgyi. net

Description: Zawgyi-One's Myanmar glyphs are designed by Zaw Win Myat of Art House. The font is produced and published by Zawgyi. net and Alpha Mandalay. It contains glyphs for English and other characters, which are from temporarily from Tahoma. Tahoma is

  • zawgyi-one Regular | ZawgyiOne20071204.ttf - 2,050 chars

    zawgyi-one Regular
  • Embed zawgyi-one Regular Font
    To embed your selected fonts into a webpage, copy this code into the <head> of your HTML document
    <link href="https://www.dafontfree.net/embed/emF3Z3lpLW9uZS1yZWd1bGFyJmRhdGEvNDUvYy8yMzY4MzUvWmF3Z3lpT25lMjAwNzEyMDQudHRm" rel="stylesheet" type="text/css"/>
    Specify in CSS
    Use the following CSS rules to specify these families:
    font-family: 'zawgyi-one-regular', sans-serif;
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
zawgyi-one Regular
!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ¡¢£¤¥¦§¨©ª«¬­®¯°±²³´µ·¸¹º»¼½¾¿ÀÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÐÑÒÓÔÕÖ×ØÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõö÷øùúûüýþÿĀāĂ㥹ĆćĈĉĊċČčĎďĐđĒēĔĕĖėĘęĚěĜĝĞğĠġĢģĤĥĦħĨĩĪīĬĭĮįİıĴĵĶķĸĹĺĻļĽľĿŀŁłŃńŅņŇňŊŋŌōŎŏŐőŒœŔŕŖŗŘřŚśŜŝŞşŠšŢţŤťŦŧŨũŪūŬŭŮůŰűŲųŴŵŶŷŸŹźŻżŽžſƏƒƠơƯưƷǤǥǦǧǨǩǪǫǮǯǺǻǼǽǾǿȘșȚțȨȩəʒˆˇˉ˘˙˚˛˜˝̴̵̶̷̸̡̢̧̨̛̖̗̘̙̜̝̞̟̠̣̤̥̦̩̪̫̬̭̮̯̰̱̲̳̹̺̻̼͇͈͉͍͎̀́̂̃̄̅̆̇̈̉̊̋̌̍̎̏̐̑̒̓̔̽̾̿̀́͂̓̈́͆͊͋͌̕̚͢͠͡ͅ;΄΅Ά·ΈΉΊΌΎΏΐΑΒΓΔΕΖΗΘΙΚΛΜΝΞΟΠΡΣΤΥΦΧΨΩΪΫάέήίΰαβγδεζηθικλμνξοπρςστυφχψωϊϋόύώЀЁЂЃЄЅІЇЈЉЊЋЌЍЎЏАБВГДЕЖЗИЙКЛМНОПРСТУФХЦЧШЩЪЫЬЭЮЯабвгдежзийклмнопрстуфхцчшщъыьэюяѐёђѓєѕіїјљњћќѝўџҐґҒғҖҗҚқҜҝҢңҮүҰұҲҳҸҹҺһӘәӨөְֱֲֳִֵֶַָֹֺֻּֽ־ֿ׀ׁׂ׃אבגדהוזחטיךכלםמןנסעףפץצקרשתװױײ׳״،؛؟ءآأؤإئابةتثجحخدذرزسشصضطظعغـفقكلمنهوىيًٌٍَُِّْٕٓٔ٠١٢٣٤٥٦٧٨٩٪٫٬٭ٰٱٲٳٴٵٶٷٸٹٺٻټٽپٿڀځڂڃڄڅچڇڈډڊڋڌڍڎڏڐڑڒړڔڕږڗژڙښڛڜڝڞڟڠڡڢڣڤڥڦڧڨکڪګڬڭڮگڰڱڲڳڴڵڶڷڸڹںڻڼڽھڿۀہۂۃۄۅۆۇۈۉۊۋیۍێۏېۑےۓ۔ەۖۗۘۙۚۛۜ۝۞ۣ۟۠ۡۢۤۥۦۧۨ۩۪ۭ۫۬۰۱۲۳۴۵۶۷۸۹ۺۻۼ۽۾฿ကḿṿếἿ᾿ﭿﯿ﴿ﺿ
  • File name: zawgyi-one.zip
  • File size: 191.4 Kb
  • 731 views, 128 downloads, 0 comment(s)
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Download free fontsAlienArtFire - IceDestroyDecorativeErodedWesternMedieval1TechnoBarcodeGroovyDingbatsPeopleSexyLCDDafont FreeTyperwriterStencil, ArmyBasicRelaxRock StoneRetroForeignVietnameseWild WestContact usCartoonFont ABCUnicodeFont thư phápChina, JapanArabicMexicoRoman, GreekVariousRussianSquareComputerChalk CrayonHolidayScratchedSportBlurredHorrorGrunge/TrashCalligraphyAnimalsSans serifAsianRoundedModernGothicDottedShapesPixel / BitmapDistortedLogosHeadsTV, MovieHeadlineTattooBrushItalicNatureComicOutlineValentineEasterDesignKidsHalloweenEsotericChristmasFantasticRunes, ElvishCurlyAncientGridScriptHandwrittenCelticFamousGraffitiGamesOld SchoolVariousFancySci-Fi3DMusicFont VNIVariousB3B1Mac OSWeddingB2C4AndroidgenieesspvBrowse by HashtagBrowse by CategoriesLeftyHTML LinkPrivacy PolicyGoogle search my data fontsFonts BlogDesign tutorialsDesign basics fonts categoriesstylescalligraphydesignsignsnaturettfce-freehandce free 1ttfcefreehandce freehandfontscategoriesfree1ttfce-classic-true-typececla1 0ttfclassictruetypece classicclassic truetrue typece classic trueclassic true typece classic true typececla10ttfceclassicceclass 1ttfceclassce-classicceclassic 1ttfTTFce-collectioncecollection 1ttfcollectionce collectioncecollectionce-excel-true-typeceexc1 1ttfexcelce excelexcel truece excel trueexcel true typece excel true typeceexc1ce-excelceexcel 1ttfceexcelcefree 1ttfcefreece-hand-writecehand 1ttfhandwritece handhand writece hand writecehandce-horizontal-thick-fontcehztttfhorizontalthickfontce horizontalhorizontal thickthick fontce horizontal thickhorizontal thick fontce horizontal thick fontcenormalcenormal 1ttfce-royalceroyal 1ttfroyalce royalceroyalce-square-outlinecesquarettfsquareoutlinece squaresquare outlinece square outlinece-titlecetitle4 0ttftitlece titlecetitle4ce-transparentcetrans 1ttftransparentce transparentcetransce-true-type-excelcetru1 1ttfce truetype excelce true typetrue type excelce true type excelcetru1woodchuck-sfpinottfwoodchucksfwoodchuck sfwin-bagowbagottfwinbagowin bagowin-beikthanowbtnttfbeikthanowin beikthanowwin-chowcho ttfwwinchowwin chowchowwin-cho-whitewchowh 0ttfwhitecho whitewwin cho whitewchowhwin-digitalwdigitttfdigitalwin digitalwinbagowin bagottfbagottfwinchinwin chinttfchinttfwinhehowin heho 0ttfhehowin-baganwinbaganttfbaganwin baganwin-bamawwinbamawttfbamawwin bamawwin-bokepyinwinbokepyinttfbokepyinwin bokepyinwin-cartoonwincartoonttfcartoonwin cartoonwin-dagonwindagonttfdagonwin dagonwin-daweiwindaweittfdaweiwin daweiwindaweiwindawei 0ttfwin-wingdingwindingttfwingdingwin wingdingwin-europawineuropttfeuropawin europawingdingswingdingttfwin-hakawinhakattfhakawin hakawin-hantharwadywinhanthattfhantharwadywin hantharwadywin-heart1winheart1ttfheart1win heart1win-heart2winheart2ttfheart2win heart2win-heart3winheart3ttfheart3win heart3win-hopinwinhopinttfhopinwin hopinwin-innlaywinilttfinnlaywin innlaywininnlaywininlay 0ttfwininlaywin-innwawininnwattfinnwawin innwawin-kalawwinkalawttfkalawwin kalawwin-kathawinkathattfkathawin kathawin-kawlinwinkawlittfkawlinwin kawlinwin-kawthaungwinkawthaungttfkawthaungwin kawthaungwin-khamtiwinkhamtttfkhamtiwin khamtiwin-kyemonewinkmttfkyemonewin kyemonewinkyemonewinkmone 0ttfwinkmonewin-kyauktanwinktttfkyauktanwin kyauktanwin-kyaukmaewinkyaukmettfkyaukmaewin kyaukmaewin-kyinetonewinkyinetonttfkyinetonewin kyinetonewin-lashowinlashottflashowin lashowin-loikawwinloikattfloikawwin loikawwin-mandalaywinmandattfmandalaywin mandalaywin-mansiwinmansittfmansiwin mansiwinmapttfwin-mawlamyinewinmawlattfmawlamyinewin mawlamyinewin-magwaywinmgwayttfmagwaywin magwaywin-meikhtilarwinmhlttfmeikhtilarwin meikhtilarwin-minbuwinminbuttfminbuwin minbuwin-mingunwinmingunttfmingunwin mingunwin-myitkyinawinmknttfmyitkyinawin myitkyinawin-mogokwinmogokttfmogokwin mogokwin-monotypewinmonottfmonotypewin monotypewin-monotypenewwinmononewttfmonotypenewwin monotypenewwin-moneywarwinmonywarttfmoneywarwin moneywarwin-mudonwinmudonttfmudonwin mudonwin-musewinmusettfmusewin musewin-myeikwinmyeikttfmyeikwin myeikwin-nanyunwinnanyuttfnanyunwin nanyunwininnwawinnwa 0ttfwinnwawinnwabttfwin-nyaungshwaywinnyaungsttfnyaungshwaywin nyaungshwaywin-phaanwinphaanttfphaanwin phaanwin-pinyawinpinyattfpinyawin pinyawin-pyinmanarwinpmnttfpyinmanarwin pyinmanarwin-pyinoolwinwinpolwinttfpyinoolwinwin pyinoolwinwin-pathanewinptttfpathanewin pathanewin-hinwinpulawttfhinwin hinwin-putaowinputaottfputaowin putaowin-pyaywinpyayttfpyaywin pyaywin-researcherwinresearttfresearcherwin researcherwin-securitywinsecurttfsecuritywin securitywin-sagaingwinsgttfsagaingwin sagaingwin-shwepyitharwinshwepyittfshwepyitharwin shwepyitharwin-sittwaywinsittwttfsittwaywin sittwaywin-shwaybowinswttfshwaybowin shwaybowin-tachileikwintachileikttftachileikwin tachileikwin-tanaiwintanaittftanaiwin tanaiwin-tantyanwintantyanttftantyanwin tantyanwin-taungyiwintaungttftaungyiwin taungyiwintgyi 0ttfwintgyiwin-thatonwinthatottfthatonwin thatonwinthayeykittarawinthaya 0ttfwinthayawin-thibawwinthibattfthibawwin thibawwin-thuwanawinthuwattfthuwanawin thuwanawin-thanlwinwintlwin 0ttfthanlwinwin thanlwinwintlwinwin-thanlyinwintlyinttfthanlyinwin thanlyinwin-taungngoowintnttftaungngoowin taungngoowin-thantwewinttttfthantwewin thantwewin-typewriterwintypettftypewriterwin typewriterwintypewttfwin-wingdingswinwdttfwin wingdingswin-yadanaponwinyadanttfyadanaponwin yadanaponwin-yaewinyaettfyaewin yaewin-yangonwinyangottfyangonwin yangonwinyadanaponwinydnp 0ttfwinydnpwin-yebyuwinyebyuttfyebyuwin yebyuwin-innwa070wiw070ttfinnwa070win innwa070win-innwa080wiw080ttfinnwa080win innwa080win-innwa090wiw090ttfinnwa090win innwa090win-innwa110wiw110ttfinnwa110win innwa110win-innwa120wiw120ttfinnwa120win innwa120win-innwa130wiw130ttfinnwa130win innwa130win-innwa250wiw250ttfinnwa250win innwa250wwin-ponnya-condwponco 0ttfponnyacondwwin ponnyaponnya condwwin ponnya condwponcowwin-burmeseboldww burb 1ttfburmeseboldwwin burmeseboldwwburbwwin-burmesebold-1ww burb1 1ttf1burmesebold 1wwin burmesebold 1burb1wwin-burmeseww burn 1ttfburmesewwin burmeseburnwwin-burmese1ww burn1 1ttfburmese1wwin burmese1burn1wwin-chonewww chon 0ttfchonewwwin chonewchonwwin-bur-am-boldwwburambttfburamboldwwin burbur amam boldwwin bur ambur am boldwwin bur am boldwwin-bur-am-normalwwburamnttfnormalam normalbur am normalwwin bur am normalwwinburmesewwburn 1ttfwwburnwwin-hlaingwwhlaing 0ttfhlaingwwin hlaingwwhlaingwwin-tagaungwwtg ttftagaungwwin tagaungwwtgwinyangonwybttfzawgyi-onezawgyione20071204ttfzawgyione

Comments (0)

  • no-avatar

    Other fonts ...

    B1

    B2

    B3

    genieesspv

    C4

    Top